Connecting talent with opportunity

Loading WeHireYou

Free for the first 200 users

Claim spot

Web Experience Engineer, Framer

HackerRank · Hybrid In New York, Santa Clara · Hybrid

engineeringhybridfresherjavascriptfigma
schedule

Posted

Today

work

Job type

Full-time

domain

Industry

IT & Software

group

Openings

1

About the role

Web Experience Engineer, Framer HackerRank helps companies like NVIDIA, Amazon, and Microsoft hire and upskill the next generation of developers based on skills, not pedigree. Our platform is trusted by over 2,500 of the world’s most innovative companies to build strong engineering teams ready for what’s next. Software has entered an era where humans and AI build side by side. As this shift accelerates, the definition of strong technical talent is changing. We give companies better ways to identify and invest in next-generation skills. People at HackerRank care deeply about the impact of their work and sweat the small details so our customers can be wildly successful with products they genuinely love to use. We move with urgency and believe great outcomes come from high standards. About the role HackerRank’s brand experience team is responsible for ensuring every market touchpoint is authentic and impressive. We care deeply about craft, leveraging technology to augment our skills and our impact, and treat every member as a builder capable of moving the brand forward. The team is growing, and we’re looking for a top-tier design engineer fluent in Framer to help us raise the bar. This role sits between design and development, working closely with stakeholders across product, marketing, and the executive team to define our vision and then implement it in modern, performant, engaging experiences. You will own the Framer site and its component system, working closely with designers and internal content creators to shape our web marketing pages through polished, production-ready code and an immersive interactive experience. What you’ll do Own the component library including custom coded components, balancing ambitious motion and interaction with performance and scalability. Ensure any custom code is production ready and secure. Manage the CMS database, connecting with third-party tools as necessary. Collaborate closely with designers and content creators and showcase your own taste and creative talents. Ensure pages perform well for international visitors regardless of device size or connection speed, degrading gracefully where necessary without impacting overall experience. Rapidly prototype ideas and work with the Framer and Figma MCPs to quickly move from concept to live site. Raise the bar on what is possible, pushing ambitious experiences that draw attention. Who you are Have a strong web engineering background, with experience working with JavaScript frameworks, Tailwind, and are comfortable working within a coded design system. Have shipped ambitious sites using Framer or Webflow and can showcase how you raise the bar for yourself and others. Can demonstrate how you ensure code you write or generate is secure and performant, orchestrating AI to achieve great results. Can confidently prototype your own ideas and move quickly between concepts into a final version with minimal outside help. Are comfortable with ambiguity and collaborating closely with executive and senior stakeholders to bring a new web experience to life. Consider yourself high-agency and proactively look for opportunities to provide impact while working in coordination with multiple contributors. Have developed fluency in AI tools and working with agents to multiply your impact. Even better if you have You have experience with CMS platforms and connecting third-party integrations within Framer. You have worked with Figma MCPs or other AI-assisted design-to-code workflows and can demonstrate the results. You have a background in motion design or advanced CSS animation and can bring a distinctive interactive quality to the web experience. You will thrive in this role if You're as comfortable in code as you are in design. You move fluidly between Framer, a code editor, and a design file, and you take pride in shipping work that's as clean under the hood as it looks on screen. Ambiguity doesn't slow you down - it motivates you. You can work alongside executive and senior stakeholders where direction evolves, and you're able to turn loose ideas into polished, live experiences. You use AI as a force multiplier, not a shortcut. You've built real fluency with AI tools and agents, and you actively look for ways to raise the quality and pace of your work through them. Compensation The base salary range for this role is $150,000 – $180,000, plus a target 10% annual bonus tied to individual and company performance. You will also receive equity (stock options) and a comprehensive package of cash and non-cash benefits. Want to learn more about HackerRank? Check out HackerRank.com to explore our products, solutions and resources, and dive into our story and mission here. HackerRank is a proud equal employment opportunity and affirmative action employer. We provide equal opportunity to everyone for employment based on individual performance and qualification. We never discriminate based on race, religion, national origin, gender identity or expression, sexual orientation, age, marital, veteran, or disability status. All your information will be kept confidential according to EEO guidelines. Linkedin | X | Blog | Instagram | Life@HackerRank Notice to prospective HackerRank job applicants: - Our Recruiters use @hackerrank.com email addresses. - We never ask for payment or credit check information to apply, interview, or work here. Hybrid in New York, NY or Santa Clara, CA

Key responsibilities

  • check_circleCollaborate with the team on day-to-day project tasks
  • check_circleLearn tools and processes used by the organization
  • check_circleDocument work and participate in team meetings
  • check_circleSupport quality checks and continuous improvement

Requirements

  • check_circleOur Recruiters use @hackerrank.com email addresses.
  • check_circleWe never ask for payment or credit check information to apply, interview, or work here.

Skills & keywords

engineerexperiencefigmaframerhackerrankhybrid in new yorkjavascriptsanta claraweb

Benefits & perks

  • check_circleMentorship
  • check_circleCertificate of completion
  • check_circleFlexible work arrangement where applicable