Connecting talent with opportunity

Loading WeHireYou

Free for the first 200 users

Claim spot

Full Stack Engineer - Connect Team

Riskified · Lisbon · Hybrid

engineeringhybridseniorjavatypescriptreactvuec#
schedule

Posted

Today

work

Job type

Full-time

domain

Industry

IT & Software

group

Openings

1

About the role

Full Stack Engineer - Connect Team About Us Riskified empowers businesses to unleash ecommerce growth by taking risk off the table. Many of the world’s biggest brands and publicly traded companies selling online rely on Riskified for guaranteed protection against chargebacks, to fight fraud and policy abuse at scale, and to improve customer retention. Developed and managed by the largest team of ecommerce risk analysts, data scientists and researchers, Riskified’s AI-powered fraud and risk intelligence platform analyzes the individual behind each interaction to provide real-time decisions and robust identity-based insights. Riskified is proud to work with incredible companies in virtually all industries including Acer, Gucci, Lorna Jane, GoPro, and many more. We thrive in a collaborative work setting, alongside great people, to build and enhance products that matter. Abundant opportunities to create and contribute provide us with a sense of purpose that extends beyond ourselves, leaving a lasting impact. These sentiments capture why we choose Riskified every day. About the Role The Connect Team enables seamless integrations between external vendor ecosystems and Riskified’s comprehensive product portfolio - including Chargeback Guarantee, Dispute Resolve, and Policy Engine. We build high-performance connectors, apps, and APIs that bridge third-party services (Payment Gateways, Return Vendors, eCommerce Platforms, and CRMs) directly into our platform. By extending our platformic integration layers and introducing cutting-edge AI and agentic solutions, our team drastically simplifies merchant onboarding and accelerates integration velocity across thousands of global eCommerce merchants. This role requires strong technical execution paired with a deep understanding of our business domain to deliver frictionless, highly reliable onboarding experiences. What You'll Be Doing - Build Integration Infrastructure: Design, develop, and maintain robust, scalable APIs, connectors, and integration layers connecting third-party platforms to Riskified's product suite. - Drive AI & Automation: Introduce and implement AI and agentic solutions into product onboarding flows to maximize speed, accuracy, and automation for merchants. - Embrace Modern Workflows: Actively utilize agentic coding tools and AI-assisted workflows to boost team development velocity and code quality. - Bridge Tech & Business: Partner with Product, Design, and Domain experts to translate complex risk, dispute, and policy business logic into elegant software architecture. - Ship to Production Daily: Maintain modern CI/CD pipelines, deploying high-quality code daily and taking strong end-to-end ownership of service reliability and performance. - Active part in planning the team roadmap and products Qualifications - B.Sc. in Computer Science or equivalent certifications - 3+ years of proven experience in hands-on server-side coding - Proven experience with server-side development languages, such as TypeScript, Scala, Java, C#, or Kotlin - Hands-on experience in a recent frontend framework (React, Vue, etc.) - advantage - Proven experience in full-stack development, with proficiency in both frontend and backend technologies - Strong business context orientation with the capacity to understand domain workflows in risk, fintech, or eCommerce - Demonstrated experience building APIs, microservices, and integration layers with databases (SQL/NoSQL) and cloud services (AWS/GCP) - Passionate about leveraging AI coding assistants and agentic tools in daily development workflows - Experience incorporating LLMs or agentic frameworks directly into customer-facing products - advantage - Independent self-learner, proactive problem solver, and strong team player We include transparent salary ranges to support fairness, clarity, and informed decision-making early in the process. The base salary range for this position is €50,000 - €75,000 gross annually for candidates based in Lisbon. Your actual salary will be determined based on your unique skills, experience, and competencies. If your expectations differ, please let us know - we’re always open to a conversation. The base salary is one part of the total compensation package at Riskified. All full-time regular employees receive a bonus target and are eligible to receive stock-based awards. Also, our value proposition goes way beyond compensation: our perks and benefits package, culture, community, and learning and development programs are just some of the elements we provide to bring value to our employees. Life at Riskified We are a fast-growing and dynamic tech company with 750+ team members globally. We value collaboration and innovative thinking. We’re looking for bright, driven, and passionate people to grow with us. Some of our Lisbon Benefits & Perks: - Hybrid mode of work - Flexible schedule - Healthcare benefits - Fully-stocked kitchens - Benefits package per month—per your choice, e.g., work-from-home equipment, gym membership, wellbeing activities, and more. - Wellness program - Celebrations and activities - Team events - Happy hours - Awesome Riskified gifts and swags - Volunteer programs - Personal development - Global onboarding - Role-based technical skills training - Full access to Udemy In the News C-Tech: We need to find the balance between leveraging innovative AI solutions and using them cautiously Built In: How We Built This: A Riskified Technologist Unpacks The Company’s Beacon Technology Globes: Riskified is among Israel’s fastest growing companies Yahoo: Riskified Earns "Top Rated" Award Across Four TrustRadius Solution Categories Riskified is deeply committed to the principle of equal opportunity for all individuals. We do not discriminate based on race, color, religion, sex, sexual orientation, national origin, age, disability, veteran status, or any other status protected by law. Lisbon

Key responsibilities

  • check_circleCollaborate with the team on day-to-day project tasks
  • check_circleLearn tools and processes used by the organization
  • check_circleDocument work and participate in team meetings
  • check_circleSupport quality checks and continuous improvement

Requirements

  • check_circleBuild Integration Infrastructure: Design, develop, and maintain robust, scalable APIs, connectors, and integration layers connecting third-party platforms to Riskified's product suite.
  • check_circleDrive AI & Automation: Introduce and implement AI and agentic solutions into product onboarding flows to maximize speed, accuracy, and automation for merchants.
  • check_circleEmbrace Modern Workflows: Actively utilize agentic coding tools and AI-assisted workflows to boost team development velocity and code quality.
  • check_circleBridge Tech & Business: Partner with Product, Design, and Domain experts to translate complex risk, dispute, and policy business logic into elegant software architecture.
  • check_circleShip to Production Daily: Maintain modern CI/CD pipelines, deploying high-quality code daily and taking strong end-to-end ownership of service reliability and performance.
  • check_circleActive part in planning the team roadmap and products
  • check_circleB.Sc. in Computer Science or equivalent certifications
  • check_circle3+ years of proven experience in hands-on server-side coding
  • check_circleProven experience with server-side development languages, such as TypeScript, Scala, Java, C#, or Kotlin
  • check_circleHands-on experience in a recent frontend framework (React, Vue, etc.) - advantage
  • check_circleProven experience in full-stack development, with proficiency in both frontend and backend technologies
  • check_circleStrong business context orientation with the capacity to understand domain workflows in risk, fintech, or eCommerce

Skills & keywords

awsc#ci/cdconnectengineerfullgcpjavakotlinlisbonreactriskifiedscalasqlstackteamtypescriptvue

Benefits & perks

  • check_circleMentorship
  • check_circleCertificate of completion
  • check_circleFlexible work arrangement where applicable